PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009593586.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 175aa    MW: 19952 Da    PI: 10.3004
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009593586.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.91.9e-53151421128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeelvv+yL+kkv++ +l++ ++i+ev++yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+++++
  XP_009593586.1  15 LPPGFRFHPTDEELVVHYLEKKVASAPLSV-TIIAEVHLYKFDPWELPSKANFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPIFTS 108
                     79****************************.89***************99999****************************************98 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +++++g+kktL+fy+g+  kg k++Wvmheyrl
  XP_009593586.1 109 nGTKKIGVKKTLIFYRGKPLKGMKSNWVMHEYRL 142
                     67788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.45E-599147IPR003441NAC domain
PROSITE profilePS5100555.85815158IPR003441NAC domain
PfamPF023657.0E-2916142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MESTGLMSGS NHLQLPPGFR FHPTDEELVV HYLEKKVASA PLSVTIIAEV HLYKFDPWEL  60
PSKANFGEQE WYFFSPRDRK YPNGARPNRA ATSGYWKATG TDKPIFTSNG TKKIGVKKTL  120
IFYRGKPLKG MKSNWVMHEY RLVDNNSSLT KKCSLRVSLM IGYCVGFTRK TVQVQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-631214417147NAC domain-containing protein 19
3swm_B2e-631214417147NAC domain-containing protein 19
3swm_C2e-631214417147NAC domain-containing protein 19
3swm_D2e-631214417147NAC domain-containing protein 19
3swp_A2e-631214417147NAC domain-containing protein 19
3swp_B2e-631214417147NAC domain-containing protein 19
3swp_C2e-631214417147NAC domain-containing protein 19
3swp_D2e-631214417147NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009593586.11e-130PREDICTED: NAC transcription factor ONAC010 isoform X3
SwissprotA2YMR01e-82NAC10_ORYSI; NAC transcription factor ONAC010
TrEMBLA0A0D2UNR04e-91A0A0D2UNR0_G
STRINGVIT_00s0375g00040.t011e-88(Vitis vinifera)
STRINGPOPTR_0011s04650.12e-88(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.15e-81NAC domain containing protein 25